Domain Genel

(28-03-2016) boşa düşecek domainler

Aşağıdaki domainler dombul.com‘dan alınmıştır.

Bugün (28-03-2016) boşa düşecek, Türkçe alan adları aşağıdadır:

06starnakliyat.com 
0kmotoaraba.com 
101oyunlar.com 
1501sanayiarge.com 
1gundaire.com 
1haftadaingilizce.net 
1ststopistanbul.com 
2015-genelsecim.com 
2015pirlantamodelleri.com 
204charmuth.com 
4ksaglik.com 
7-gundeingilizce.com 
724acikmagaza.net 
724haberturkiye.com 
abdestore.com 
acarkentkurutemizleme.com 
acibademdeevdenevenakliyat.com 
acikkapidanismanlik.com 
adanadaily.com 
adanahurdacilik.net 
adanataxis.com 
adcelikel.com 
ademdalgic.com 
ademerdogan.com 
afireklam.com 
afn-enerji.com 
agaminsaat.com 
agammuhendislik.com 
ahidanismanlik.com 
ahsapkonservasyon.com 
akaliteburada.com 
akcaydekorasyon.net 
akdemirkuyumculuk.com 
akhaberci.org 
akillimakinaci.com 
aksarayilaclama.com 
aksobilisim.com 
alaattinzengin.com 
alacatihaber.com 
alanya-turkey.com 
alanyadaotokurtarma.com 
alanyadayolyardim.com 
alemoyunlar.com 
alisveris-oyunlari.com 
allahinkitabi.com 
almancaailebirlesimisinavi.net 
alternatifdunya.com 
altinmakasatasehir.com 
altinordusurucukursu.com 
altinpirlantatektas.com 
ambalajdukkanim.com 
aminsazanedimas.com 
anadoluyazar.com 
anaokulrehberi.org 
ankara-bayanescort.net 
ankara138.com 
ankaraadaylari.com 
ankaradahurda.com 
ankaraevdenevenakliyatfirmalari.net 
ankarakamu.com 
ankarakombiservisi.org 
ankarasonsuzvida.com 
ankaratrapezvida.com 
ankaraville.com 
ankorganizasyon.com 
annebebekburada.net 
antalya-eticaret.com 
antalyabox.com 
antalyacamsistemleri.com 
antalyadaily.com 
antalyasinemalari.com 
antalyavacays.com 
antalyavm.com 
antfinike.com 
antikali.com 
aofkitapcisi.com 
aprontekstil.com 
aracmuayene-randevualma.com 
arasteknoloji.net 
arenahotelistanbul.com 
armutalanemlakmarmaris.com 
arshamtarabar.com 
artionsekizfc.com 
aryadijital.com 
asvizyonkagitcilik.com 
atasehir-hali-yikama.com 
atasehirdeyikama.com 
atchafalayabasin.org 
atokablockchain.com 
atsreklamtasarim.com 
avrasyaemlak.net 
avtomagservis.com 
ayakkabilardafirsat.com 
aydaorganizasyon.com 
aydinpinarmobilya.com 
aydinusta.com 
aydogangazete.com 
aysohbet.com 
aytekskumas.com 
azcinsaat.com 
azerturkemlak.com 
babesinabox.com 
bademkahvalti.com 
bagelistanbul.com 
baharokulu.com 
baharturk.tv 
bahcemtarim.net 
bakiciilani.com 
bakircaysevdam.net 
bakirkoynakliyat.net 
balbeyrumeliborek.com 
balikesirevdenevenakliyat.com 
banyohavlusu.org 
barbi-oyunlari.net 
bariyersistemlerikocaeli.org 
barkodkontrol.com 
bartindugunorganizasyon.com 
basimageldi.com 
bayanca.org 
bayanlariazdirandamla.com 
bayanpartnerim.com 
bayindirnazarcicekcilik.com 
baymakdogateknikservis.com 
bebegimemasaj.com 
bebekingkong.com 
bebekkurabiye.com 
bebekmasaj.com 
bebekop.com 
bebekvarsa.com 
bedestenyorgan.com 
bekirustaadanakebab.com 
bekrsazan.com 
benimfirsatcim.net 
berkmatbaa.com 
besiktastarihi.com 
besipazari.com 
bestturturizm.com 
beyazaltinpirlantatektas.com 
beyazkayailetisim.com 
beyazmurat.com 
beyaztuval.com 
beylikduzuotoanahtar.com 
beyogludaily.com 
beyoglutoday.com 
bibercafe.com 
bigaacikotopazari.org 
bigaotopazari.org 
bikis.net 
bilcozegitim.com 
bilenteknikservis.com 
bilgi-kurs.com 
bilgiedinmemerkezi.com 
bilginiyaz.net 
bilgiperest.com 
bilincaltitedavisi.com 
binacamfilmleri.net 
bisikletciabi.net 
bisikletimcalindi.com 
bitki-sozlugu.com 
bitkiselyagsanayi.net 
bizimdugunegel.com 
bodilima.com 
boldreklam.com 
bolgeklimaservisi.com 
bormuzik.net 
borsae.org 
bostancidaevdenevenakliyat.com 
boyacilardagitim.com 
btp-haber.com 
buhariosinbajo-2015.com 
bukebalikevi.com 
bulasika.com 
bulentisildak.com 
buradacokucuz.net 
bursaacarspotesya.com 
bursaisiyalitim.net 
bursakalebayrak.com 
bursatemizlikhizmeti.com 
bursatemizlikhizmeti.net 
butikhizmet.com 
cakirotocikmaparca.com 
cambalkonyasamkent.com 
canakkale17burda.com 
canlianaliz.com 
canlicanlisikis.com 
canlikupon.com 
capaniinsaat.com 
capecodsandal.com 
carsambafidancilik.com 
carsibasiyapi.com 
cekilist.com 
cekmekoy-hali-yikama.com 
cekmekoydeevdenevenakliyat.com 
celikkapifiyati.net 
cemdolarespordia.com 
cepsepet.net 
cepsohbet.org 
cereninsepeti.com 
cerezmakinasi.org 
cerkezkoykombiservis.com 
cesarperez.net 
cetinmakinasanayi.com 
cettemizlik.com 
cewimobilya.com 
ceyizbox.com 
ceyizbox.net 
ceylankirtasiye.net 
ceylanyapimarket.org 
cezayirdanismanlik.com 
chiangmaikaset.com 
chiangraikaset.com 
cihangirkoleji.org 
ciltleketedavisi.com 
cinerdenizcilik.com 
citirguzeller.com 
clickportatil.com 
cokfirsat.com 
corbataygemelos.com 
corpoementemelhor.com 
cozelti.com 
crbilisim.com 
credo-kazan.com 
criddergidder.com 
cucinare.org 
dagsakinleri.com 
dailyadana.com 
dailyankara.com 
dailyantalya.com 
dailybeyoglu.com 
dailyizmir.com 
dailykadikoy.com 
daleelturkiye.com 
dantemuzikmerkezi.com 
davethetechieguy.com 
davettelynnhrabakwi.com 
davranma.com 
decorapapeldeparede.com 
dedoktorum.com 
defnevillalari.com 
defosepeti.com 
degisimstrateji.com 
degisql.com 
dekorasyonchu.com 
deltadekorasyon.com 
demirbilekliyiz.com 
demircigundem.net 
denizcicekcilikorganizasyon.com 
denizli2015.com 
denizliakvaryumshop.com 
denizlileblebisi.com 
deniztc.com 
denizuygur.com 
denizyakarinsaat.com 
densamuhendislik.com 
dergahkebap.com 
dericeketboyama.com 
derinbanyo.com 
derinmutfak.com 
destaservis-tesetice.org 
detamedya.com 
detaytemizliksilivri.com 
deviris.com 
dianelektronik.com 
diclemmobilya.com 
dijitalkarne.com 
dijitalmuzik.net 
dijitalsinif.com 
dijitalvatandaslik.net 
dipnothaber.com 
disdoktorunuz.net 
diyarbakirkebapsalonu.com 
diyarbakirkebapsiparisi.com 
diyetkurabiye.com 
dogandcatville.net 
dogandondurma.com 
dogumgunuevi.com 
dogumgunuevi.net 
dogumgunuevi.org 
doktormustafacaniklioglu.com 
dolu-hasar-tamiri.com 
doluekibiturkiye.com 
dondurmamakineleri.com 
donerkapi.org 
dublajstudyo.com 
dublajtr.com 
dublajvideo.com 
dublajvideolar.com 
dublajvine.com 
dubsmashturkiye.org 
dugundansiizmir.com 
dugunegel.com 
dugunhikayesivideo.com 
dugunkusadasi.com 
dukkangayrimenkul.net 
dukkangez.com 
dukkangez.net 
dunyagrupjeoloji.com 
dunyapiyasasi.com 
durumyedegit.com 
e-giyim.net 
e-ticaret-paketi.com 
ecigkofte.com 
ecoorganikbebek.com 
edessaelektrik.com 
efsanekuafor.com 
egeelektrik.net 
egeniftarim.com 
egeniftarim.net 
egitim-bilgisi.com 
egitimekaynak.com 
ehlitatil.com 
ekonomikkaplama.com 
elcinkoyuncu.com 
elektronikritim.com 
elginmuhendislik.com 
elizikisiseltasarim.com 
elmakaydinlatma.com 
elmasbebe.net 
eminarslaninsaat.com 
emlak-tur.com 
emlak68.net 
emlakkulubu.net 
emredemir.net 
emsakagit.net 
enesbilisim.com 
enkaliteliburada.com 
enyakinservis.org 
eperkek.com 
epilasyonkocaeli.com 
epoksizeminboyasi.org 
erdemhareketi.com 
erdemhareketi.net 
erdemliweb.com 
erdemsimsek.net 
erdogankombi.com 
erenerenerji.com 
ergulcihangirvakfi.org 
erkanaydin.com 
erkekadam.net 
erkekbilisimci.com 
erkekpazari.com 
ermuotomotiv.com 
escortbayannedir.com 
esenlertabela.com 
esenlerugurtemellisesi.com 
esenplastik.com 
esepetin.com 
esigaraci.org 
esistempazari.com 
eskisehirwifi.com 
eskisehirwifi.net 
eskortfiyat.com 
eskortgecelik.com 
etiketmakinam.com 
etiketmakinem.com 
etilerdeevdenevenakliyat.com 
etsaksesuar.com 
etzmadencilik.net 
euro-elektronik.com 
evimikirala.com 
evinesepetle.com 
fakirgezgin.net 
falcicafe.com 
falciyiz.com 
fastcarsinfo.com 
felahemlak.com 
fenerbahceispartafutbolokulu.com 
ferrolikombiservisi.org 
fidanbilisim.com 
filogiyim.com 
filoz.net 
fincanilo.com 
finsandheels.com 
firinlikodun.com 
firinlikodun.net 
firsatsepet.com 
firsattelekom.com 
fiyata-bak.com 
fonhaberi.com 
forum-3boyutluyazici.com 
forumdunyasi.com 
fotosincan.net 
frigkimya.com 
fundagureaydin.com 
furkanturizm.net 
futbolcaliente.net 
gabilehikaye.com 
galfan-galvanized-wire.com 
ganimet.org 
garantilialisveris.com 
gaziosmanpasaciceksiparisi.com 
gebzekompresorbayi.com 
gebzekompresorhavasan.com 
gebzekompresorservisi.com 
gelenek-gorenek.com 
gelibolusatiliktarla.com 
genyamuhendislik.com 
gercekdunya.net 
geyvemeyve.com 
giresunkariyer.com 
girisimofset.com 
gitmenu.com 
giyimmagazalari.net 
gizlisaklitatil.com 
golgeboyalari.com 
golgeoyunum.com 
gomlekcinizlevent.com 
gonulaskim.com 
gorukleemlak.net 
gozlukshow.com 
goztepedeevdenevenakliyat.com 
grafakir.com 
gullucematbaacilik.com 
gumusotel.net 
gumuspalacigkofte.com 
gunduzmimarlik.com 
gunduzspotesya.com 
guneskontrolcamfilmi.com 
guneskorumacamfilmi.com 
guven-tarim.com 
guzeltepespor.com 
haber1453.net 
haberakademi.net 
haberdehasi.com 
haberellibes.com 
haberiye.com 
hakikizeytinyag.com 
hakmenticaret.com 
halilibrahimakdogan.com 
hammaddemarketi.com 
hamsici.com 
hamuskitapevi.com 
hasanguclu.com 
havuzfiyatlari.com 
haydisohbet.com 
hayvanciyizfm.com 
hdfilmleriizlesene.org 
hediyelikesyaci.com 
hediyeliklerim.com 
hediyelikplaka.com 
hekimankara.com 
hekozmetik.com 
helalticaret.net 
helalticaret.org 
helvacioksuzler.com 
heybeden.com 
hhikayeci.com 
hidroponiaverdemais.com 
highspeedkamera.com 
hiorgs-magazin.net 
hipnozla-ingilizce.net 
hissiyat.org 
hissiyatdergisi.org 
hitkozmetik.com 
hitkozmetik.net 
hmninsaat.com 
hollyorganizer.com 
hometutordekho.com 
horlamaonleyiciyastik.com 
hotelanolagangtok.com 
hotelokuraistanbul.com 
hsamedya.org 
htyotomotiv.com 
hukukdanismanim.net 
hukuksalboyut.com 
humanofistanbul.com 
husibodrum.com 
iddiabayi.net 
ihaledanisma.net 
ihtiyarogluturizm.com 
ikidebir.com 
ikminsaat.com 
ilkheyecanilkalisveris.net 
imalattanhalkasatis.com 
imrenaydinlatma.com 
inegoldugun.com 
inegolgokhanyapi.com 
inegolmototime.com 
inegolorganizasyon.net 
insaatduvarustasi.org 
insaaticinhersey.com 
intizarhaber.com 
ipektekstil.net 
ipekyolu.org 
isiyalitimbursa.net 
israanahtar.com 
istanbul-is.com 
istanbuladaylari.com 
istanbularaccikmamarket.com 
istanbulborekkebab.com 
istanbulbutikpasta.com 
istanbuldugunhikayesi.com 
istanbulemlakrentacar.com 
istanbulevdefiziktedavi.net 
istanbulgonulluleri.net 
istanbulhavuzfirmalari.com 
istanbulhukukburolari.com 
istanbulkadinsagligiexpo.com 
istanbulkadinsagligifuari.com 
istanbulkiyametvaktihileleri.com 
istanbulklimaservisleri.net 
istanbulklise.com 
istanbulmyguide.com 
istanbulotocikmamarket.com 
istanbultravestiturk.com 
istanbulvacays.com 
istanbulvetlab.com 
istanbulwomensexpo.com 
ithalkozmetik.com 
ithalkozmetik.net 
iyilastik.com 
iyilastik.net 
iyiyazilim.com 
izmarit.net 
izmir-jinekoloji.com 
izmir-kurtaj.com 
izmiradaylari.com 
izmirdugundansi.com 
izmirhavaalaniarackiralama.org 
izmirkekemeliktedavisi.com 
izmirpanjurmarket.com 
izmirpanjurservis.com 
izmirplaka.com 
izmiruzaktanegitim.com 
izmirviparackiralama.com 
jasminaksesuar.com 
javaogren.com 
joyasfutbol.com 
jualankenari.com 
jualanpulsamurah.com 
kadikoydaily.com 
kadikoydeevdenevenakliyat.com 
kadinazdiricidamlalar.com 
kadinsagligifuari.com 
kadirerzurumlu.com 
kagitcizade.com 
kakilimo.com 
kalamabalik.com 
kalamabalik.net 
kalamabalikcilik.com 
kalamabalikcilik.net 
kalemotomotiv.com 
kaliteliescortbayan.net 
kalpgulusohbet.com 
kamudanismanim.com 
kangalope.com 
kaplanmobilyadekorasyon.com 
kaptanoyun.com 
karabateknologies.com 
karadefter.net 
karadenizlileroto.com 
karamanambalaj.com 
kargombedava.net 
karina-romantika.com 
karmaistanbul.net 
karsidukkan.com 
karsiyakayacth.com 
karsiyakayacthport.com 
karsiyakayatlimani.com 
kartalkolik.com 
kartonpiyerkalibi.com 
kartvizityukle.com 
kaybedenlerclubu.net 
kayseriotomobilkiralama.net 
kayserirentcar.com 
kdzeregliakparti.org 
kdzereglisigortashop.com 
kedimikopekmi.com 
kervansaraycini.com 
keskinboyakatalog.com 
kesmekes.com 
keyfisedamersin.com 
khadamat-aroosi.com 
kimyadevi.com 
kiralikzirhliaraba.com 
kiralikzirhlimercedes.com 
kirazagaciorganizasyon.com 
kirazagaciparti.com 
kirbasotomotiv.org 
kirmizitabela.com 
kirsehirsimitcidunyasi.com 
kitabinipaylas.com 
kitapkoltugu.com 
kitapkoltugu.net 
kitapkoltugum.com 
kitapkoltugum.net 
kitaps.com 
kiyafetcini.com 
klanmuziklab.org 
klisetasarim.com 
klisetasarimi.com 
kocaelikompresorservisi.com 
kocaelireklamgazetesi.com 
koftevar.com 
kokosdukkani.com 
kokudukkani.com 
kokulusabunruyam.com 
kolaybulma.com 
kolaysacekimi.com 
kombecimantakyalezzetleri.com 
kombicim.org 
kombimatik.com 
kombiparcalari.com 
komedicetesi.com 
komik-oyunlar.net 
konutfirsati.com 
konyaadayiniseciyor.com 
konyagulkuyumculuk.com 
konyailahigruplari.com 
konyapidetandirevi.com 
konyavekiladaylari.com 
konyavekiliniseciyor.com 
koraytekstil.com 
korfezbayi.com 
korfezdetatil.net 
korfezgayrimenkul.com 
korfezveterinerklinigi.com 
korykostantuni.com 
kosekoltukhouse.com 
kostumee.com 
koysepetegelsin.net 
koysepetegitsin.net 
kozmetikstok.com 
kozmetikstok.net 
kuaicanliansuo.net 
kucukbas2014.com 
kucukerdemizolasyon.com 
kugutanitim.com 
kulasiyaset.com 
kurabiyehavuzu.net 
kurs-bilgi.com 
kursunluselalesi.net 
kurutemizlemeacibadem.com 
kurutemizlemecamlica.com 
kurutemizlemefirmalar.com 
kurutemizlemekampanyasi.com 
kurutemizlemeumraniye.com 
kuruyemismakinasi.org 
kusadasi-dugun.com 
kutahyaalisveris.com 
kutahyafirsat.com 
kuzeykibrisrehberi.com 
kuzeymadencilik.org 
ladoganawine.com 
lagumusic.com 
laledugunsalonu.com 
landbondbalta.net 
lazborekcim.com 
leblebi.org 
lepongolafirma.com 
leylademirkaya.com 
lezhikaye.com 
lezzetnerede.com 
limoncicekcilik.org 
linkhavuzu.com 
lkatekstil.com 
lodosorganizasyon.com 
lokasikampus.com 
loliconsanonimos.com 
lougedergi.com 
loveshinsan.com 
macdanismanlik.com 
macrosoftyazilim.com 
magazapos.com 
magazinru.com 
magazinsrubov.com 
maisonemlak.com 
makinehalisihaliyikama.com 
makinesatisikurutemizleme.com 
malatyakaysisi.com 
malatyapetshop.com 
malatyasucusu.com 
malerfirmaherlev.com 
malidunya.com 
maltepe-hali-yikama.com 
maltepearistonkombiservisi.com 
maltepedemirdokumservisi.org 
manavgatcam.com 
manavgatselalesi.net 
manavimpex.com 
mangalapuzha1989.com 
manisabilginbilgisayar.com 
mantaraypos.com 
masalci.org 
masalhediyelik.net 
masalkurabiye.com 
masjed-shamamb.com 
mavipapyon.org 
mcdotomotiv.com 
mediafirma.com 
medyabaz.com 
medyatotal.com 
megabursa.com 
megamuzik.tv 
melikgazicelikcati.com 
memurasor.com 
mersinevdenevetasima.com 
mersinkeyfiseda.com 
meselamuzik.com 
meslekler.org 
minikellerkonya.com 
minoxidilsampuan.net 
mirayyazilim.com 
mixresim.com 
mobilguzel.com 
mobilguzeller.com 
mobservis.com 
monclerdekaufen.com 
mpsistemi.net 
msnemlak.com 
muglaescort.com 
muglavacays.com 
multioyun.net 
mundoganancias.com 
mutlutasarimlaratolyesi.com 
muzikabezgranica.com 
muzikdoktoru.com 
muzikmaschine.com 
mylojistik.com 
myorganizedstyle.com 
myrayasamkoclugu.com 
mysatinalma.com 
nakliyeciara.com 
namutenahi.com 
nebastone.com 
netdanismani.com 
netonabiye.com 
nevayareklam.com 
nevayatanitim.com 
nezamanemekliolabilirim.net 
nicomediareklam.com 
nigdeavrupaperde.com 
nigdeperde.com 
niszczeniedokumentacji.com 
nitrat.org 
niziprehberi.com 
nlp-ingilizce.com 
nohutpilaw.com 
noktalidefter.com 
nurgulorganizasyon.com 
odakahvaltioteller.com 
odunfabrikasi.com 
odunfabrikasi.net 
ofilmburada.com 
ofistmakina.com 
ofistplastik.com 
okulsessistemi.net 
okulsessistemleri.net 
okumakayricaliktir.com 
olagansupheli.com 
onotoyedekparca.com 
optikdunyasi.com 
ordeminsaat.com 
organikcigkofte.com 
ortakbaski.com 
oskarheykeli.com 
otelbukletmalzemeleri.org 
otlasotomotiv.com 
otokiralamafirmalari.net 
otoklimaparcasi.net 
otomotivcamfilmi.com 
otoyedekparcamarketim.net 
ovaleelektroniksigara.com 
oyun-konsolu.com 
oyunaramamotoru.com 
oyunav.com 
oyuncubenim.com 
oyunlari-oyna.net 
oyunlarisue.com 
oyunpili.com 
oyunsun.org 
oyunu3doyna.com 
ozaymakina.com 
ozdaglarmobilya.com 
ozdemirsoft.com 
ozelakademitanimerkezi.com 
ozkanlarinsaatyapi.com 
ozkocaelektrik.com 
ozlemdanismanlikhizmetleri.com 
ozrehabakimhizmetleri.com 
paidvertsturkiye.com 
panniyankaraoilmill.com 
parakazanmaninyolu.com 
parcatlkredi.com 
paslanmazboruimalat.com 
pastirmaburada.com 
pazarciabla.com 
pazartesisendromu.com 
pekmezkola.com 
pelikanaksesuar.com 
penguenmail.com 
penkamobilya.com 
petek34.com 
phayaokaset.com 
piknikmalzemesi.com 
pinarbingol.net 
pirlantatektasmodelleri.com 
piyasadunyasi.com 
plmagazin.com 
ponnohut.com 
powerbankair.com 
profesordoktormustafacaniklioglu.com 
promosyonchu.com 
radyocamlihemsin.com 
radyodenis.com 
radyonuklidtedavi.com 
radyosir.com 
radyour.com 
ramazanertan.com 
raspadergi.com 
rc-pancar.com 
readanalog.com 
reklamcimalzemeleri.com 
reklamciurunleri.com 
reklamvermatik.com 
rexsercena.com 
reyhantas06.com 
richmondistanbulhotel.com 
rossocigkofte.com 
royalnettasarim.com 
rustudumanli.com 
ruzgarsaat.com 
s-emlakgayrimenkul.com 
sabah-inc.com 
sabah88.com 
sabaharena.com 
safyasam.com 
safyasam.net 
saglikyildizi.com 
sahilotoemlak.com 
sakaryadahaliyikama.com 
sakaryarehber.net 
sakaryaslowfm.com 
sakimya.com 
saldukkani.net 
samsundataksi.net 
samsunduymed.com 
samsunesc.com 
samsunesc.net 
samsunfidancilik.com 
samsunfotograflari.com 
samurayx.com 
sanal-hizmetler.com 
sandalean.com 
sandizell.org 
sanliurfaklima.net 
sansardillon.com 
santoroscarwash.com 
sarabande912.com 
saranbaharat.com 
saribilgisayar.com 
sathiyaraja.com 
satilikc180.com 
satilikc200.com 
satilikdairelerevler.com 
satilikkonutum.com 
satilikvito.com 
savsak.net 
sayerdekorasyon.com 
sazangddal.com 
sazmagazin-orderhilfe.com 
sbkisitmasogutma.com 
sdavets.org 
sdpidekebap.com 
seccadedunyasi.com 
sedamutfak.com 
sedatotomotiv.com 
seheminsaat.com 
sekssohbet.com 
selcukuzaktanegitim.com 
sellmyhomekansascity.com 
sembolturizm.org 
semotobursa.com 
senassogutma.com 
senolelektrik.com 
sepetmanya.com 
sepetmanya.net 
serhadtekstil.com 
serinbilisim.com 
sertifikaliorganikkozmetik.com 
servis4u.net 
sesliodemesistemi.com 
sesliyanitsistemi.com 
sessizmedya.com 
settemele.net 
seyahatnet.net 
shuremikrofon.com 
sibop.net 
sigaraylamucadele.org 
siirticinprojemvar.com 
silikonskefutrole.com 
simsarturkiye.com 
sinemaseverler.net 
sinematik.org 
sinemreyhan.com 
sinopfem.com 
sirinmakina.net 
sisjenerator.com 
sivasozel.com 
smartoyunmobil.com 
smartoyunmobil.net 
sohbetgoruntulu.com 
sokfiyatlar.net 
sommerdenizemlak.com 
sondakikahaberdetay.com 
sonkampanyalar.com 
sonsesotomuzik.com 
sonsporhaber.com 
sonsuzdestek.net 
soyorganization.com 
soyundular.com 
sribruhaspati.com 
stilistik.net 
stokkozmetik.com 
stokkozmetik.net 
storperdenasiltemizlenir.com 
suadiyedeevdenevenakliyat.com 
sultankarakovan.com 
sundus.org 
sunucunoktasi.org 
supersacmalarim.com 
surf2istanbul.com 
surmeotomotiv.com 
sushinsantcugat.com 
suzernakliyat.com 
tabanlik.org 
tabelachi.com 
takipcimagazasi.com 
tamircinim.com 
tamkainsaat.com 
tampansiyonoteller.com 
tarakankreatif.com 
tarakhara.org 
tarotsaray.com 
tartimdiyetmerkezi.com 
tasarimdas.com 
tasavvufmuzigi.org 
tasoyun.com 
tatilevet.com 
tatilevet.net 
tatlitelaslarimtasarim.com 
tavukcuogluyapigrup.com 
tavukcuogluyapigrup.net 
tcaydin.com 
tcaydin.net 
tdedankara.org 
teddiyarbakir.com 
teknolojihocam.com 
teknolojiksaglik.com 
teknoyemek.com 
tekstilbutik.com 
telefonlaodeme.com 
temelugurlisesi.com 
temizyumurta.org 
temocelikkapi.com 
tenislitatil.com 
ters.tv 
teymencelik.com 
thebarut.com 
thedoner-inc.com 
theparcatpruneyard.net 
theresakinkforthat.net 
thietbinghekimhoan.com 
thurmanmurman.com 
tibbiatikterazi.com 
tibbiatikterazisi.com 
tibbisaglik.com 
timebeyoglu.com 
timesankara.com 
timesbeyoglu.com 
tomrukaksesuar.com 
tongfuhuoyun.com 
toptanfirsat.com 
toptanyuzuk.com 
toycanemlak.com 
toyunnan.net 
traveltobursa.net 
trendaksesuar.net 
trendkagit.com 
trendkagit.net 
trendmatbaa.net 
trendpromosyon.net 
trmedyagroup.com 
truemagazin.com 
tufanatalarpirlanta.com 
tukenmezkalemleketemizleme.com 
tuketicibilgilendirme.org 
tumkizoyunlari.com 
turan-haber.com 
turizmtivi.com 
turkcehaberkaynagi.com 
turkcehdfilm.tv 
turkiyeadaylariniseciyor.com 
turkiyeeskort.com 
turkiyehomes.com 
turkiyeklise.com 
tutuncuali.com 
tuzlayasam.com 
tvkamera.com 
ucuzkirdugunu.com
ukraynarehberlik.com 
ulasdogan.com 
ulastiayakkabi.com 
ulastirlojistik.com 
ulastitekstil.com 
ultramagazin.com 
ulugolsigorta.com 
ulviorganik.com 
umitkoycayyolutesisat.com 
umraniyedeevdenevenakliyat.com 
umutceyhan.com 
unaldekorasyon.com 
unutulmayanfilmler.net 
usanc.net 
uskudardaevdenevenakliyat.com 
utmak.com 
uttarakhandlions.com 
vadizmir.com 
vakithaber.net 
varis-tedavisi.com 
vbanyou.net 
veerkek.com 
veerkek.net 
vibedelics.com 
videohaber.tv 
vinccaraskaltamir.com 
vipozeldersankara.com 
warungorganik.com 
webavukatim.com 
webotopazari.com 
webtasarimtoplist.com 
whitehousepets.com 
widifirmansyah.com 
wiko-elektronik.com 
wiko-elektronik.net 
winsanook.com 
womensexpoistanbul.com 
yagmurhalicilik.com 
yalcinbilisim.com 
yalovakariyer.com 
yalovakariyer.net 
yanginmerdivenisirketleri.com 
yanikkalem.com 
yapielektrik.com 
yarasagubre.com 
yaraticiyazarlikveceviri.com 
yarimpansiyonoteller.com 
yasamindogasi.com 
yasinyaylaoglu.org 
yatakbandi.com 
yatakburda.com 
yelenemlakizmir.com 
yeni2kisilikoyunlar.com 
yeni3doyunlar.com 
yeniankara.net 
yenibentenoyunlari.com 
yeniboyamaoyunlari.com 
yeniciftlikoyunlari.com 
yenilezzetinegol.com 
yenipastaoyunlari.com 
yenisilahoyunlari.com 
yenitakidunyasi.com 
yeniyarisoyunlari.com 
yenizekaoyunlari.com 
yentesenerji.com 
yerlidizifullizle.com 
yesilbir.com 
yesilbir.net 
yildirimsavar.com 
yildiz4ktekstil.com 
yildizotomotivgebze.com 
yildizreklamgemlik.net 
yogurtludondurma.com 
yoncanikahsekerim.com 
yorganevi.com 
yorganevi.net 
yorukoglu-emlak.com 
yunusemreertem.com 
zabaski.com 
zambakbayi.com 
zevklialisveris.net 
zeytinyagsabunlari.com 

(Toplam 1082 domain)

Eski günlerde düşen domainlere ulaşmak için TIKLA.

Yazar Hakkında

Mustafa SEVİNÇ

Yorum Alanı