Domain Genel

(29-01-2016) boşa düşecek domainler

Aşağıdaki domainler dombul.com‘dan alınmıştır.

Bugün (29-01-2016) boşa düşecek, Türkçe alan adları aşağıdadır:

21araliktanevar.com 
21araliktanevar.net 
23subatgencligi.com 
300formanave.com 
3boyutluduvarkagidi.net 
3boyutluyazici.net 
5188ozelguvenlikelbiseleri.com 
5188ozelguvenlikkiyafetleri.com 
555emlak.com 
abihayatcesmesi.com 
aboneligi.net 
acapatricfutbolsala.com 
acarturizm.net 
acilelektronik.com 
acilyemektarifleri.com 
adanaahenkturizm.com 
adanabobinaj.net 
adanacmoly.net 
adanahaber01.com 
adanahaber01.net 
adanahaberler.net 
adanakaskosigorta.com 
adelmakina.com 
adgfutbol.com 
adhipradana.com 
adidasesofmanlar.com 
adlibelgeinceleme.com 
afrikatarimplatformu.org 
afyontasarimyapi.com 
agkmeclis.org 
ahneredevahnerede.com 
akalanya.com 
akalanya.net 
akanelektronik.com 
akanpsikolojikdanismanlik.com 
akcayotelleri-tr.com 
akcifcitarim.com 
akresemlak.com 
aksarayuzem.com 
aksesuarbankasi.com 
akyolmadeniyag.com 
alacatikumru.com 
alanyaadinotel.com 
alanyaexpats.com 
alanyaotelleri-tr.com 
albayan-mag.com 
albayrak-elektrik.com 
albeniemlak.net 
alestakoltuk.net 
alhekim.com 
aliacarelektrik.com 
alisveris90.com 
alka-diyeti-zayiflama.com 
alkanpromosyon.org 
almanyadanalisveris.com 
alosutesisat.com 
aloustaankara.com 
aloyemekservisi.com 
alpaylartemizlik.com 
alphariceturkiye.net 
altieylulbelediyesi.com 
altinpaletreklam.com 
altinsaraykuyumculuk.com 
altunizadebilgisayarservisi.com 
am-servis.net 
amasyasuaritmabayi.com 
anatoliayatak.com 
anatolyumakademi.com 
anayurthaber.com 
ankara-nakliyat.org 
ankaraakis.com 
ankaraelittravestileri.com 
ankaraevdenevenakliyatfirmalari.org 
ankaraindirim.com 
ankaraozelservis.com 
ankaraprintonline.com 
ankaratercumeankara.com 
ankaravalisi.org 
annebebekurunleri.net 
anonimtasarim.com 
antalyaatletik.com 
antalyabasket.com 
antalyacilekshop.com 
antalyadakiralikvilla.com 
antalyaduyguoptik.com 
antalyaotelleri-tr.com 
antikamuzesi.com 
apleksmatbaacilik.com 
appleparca.net 
appmagaza.com 
appmerkez.com 
arabambozuk.com 
arabaminustasi.com 
arabamsatlik.com 
arachizmetleri.com 
arackamerasisatisi.com 
arcelikalalim.com 
arcelikuskudar.com 
ardaalpaslan.com 
ardaaluminyum.com 
ardahanda.com 
ardahanda.net 
ardahandegirmenlikoyu.com 
aresteinsaat.com 
aristoteknikservis.com 
armegaplastik.com 
armutshop.com 
artbakkal.com 
asansorpiyasasi.com 
ascsigorta.com 
askagalvaniz.com 
askiyakitap.com 
asktasarim.com 
asmayapragi.com 
asrupasutesisati.com 
asusparca.com 
atakarmuhendislik.com 
atalantebilardocafe.com 
avantikagroup.com 
avci-mobilya.com 
avcicumhuriyeti.com 
avcilarharputemlak.com 
avisalanya.com 
avrupahavaifisek.com 
avrupaklimaservis.com 
axeticaret.com 
ayakkabireyonu.net 
aycayapiemlak.com 
aydemirlerinsaat.com 
aydinguzyurdu.com 
aymantar.com 
ayparhaber.com 
azginhikaye.com 
babaoglunakliyat.com 
bahargulumsesli.com 
baharisaoglu.com 
baharisco.com 
bajaorganikjc.com 
bakimhareketi.com 
bakimlisac.org 
bakimlisaclar.org 
bakimmerkeziyazilimi.com 
baleegitimi.net 
balikbayangifts.com 
balikesirmdcdemir.com 
balkayaenerjibasvuru.com 
balkayaenerjibasvuru.net 
balmuhendislik.com 
balrehber.com 
bandajesusparaomundo.com 
bankasorgu.com 
barabara.net 
bardakcilardagkaplicasi.com 
barkod-market.com 
basariauto.com 
basaridernegi.com 
basaridernegi.net 
basaridernegi.org 
basarikariyermerkezi.com 
basimmukemmelist.org 
basimmukemmelliyetmerkezi.org 
baskanlikakademisi.com 
baskicanavari.com 
baskinrobbins-pan.com 
baskionline.net 
basmuhendissondaj.com 
batuhanbakirarar.com 
bayanicgiyim.tv 
bayanlarsoruyor.net 
bayanpantolonmodelleri.com 
baykus.tv 
bazenservisbeograd.com 
bebaykibris.com 
bebekdavetiyesi.com 
bebekistan.com 
bebekten.org 
bedanismanlik.com 
begecasansor.com 
berettakombiservis.com 
berjerinburada.com 
besakina.com 
besinpiramidi.com 
bestmarket-organikgida.com 
bicakstore.com 
bilencocuk.com 
bilgi8.com 
bilgidelisi.net 
bilgidoktor.com 
bilginmuzik.com 
bilginvakfi.org 
bilgisayarbizimisimiz.com 
bilgisayarcik.com 
bilgivebelgesizdirmayason.com 
bilimei.net 
bilimkurgurehberi.com 
bilisimelektrikelektronik.com 
binicilikmagazasi.com 
binicilikmalzemeleri.net 
birileriemlak.com 
birincidishastanesi.com 
bizimhikayeler.com 
bizimleticaret.com 
blogantalya.com 
blokbankasi.com 
bmcorganizasyon.net 
bodrumotelleri-tr.com 
bogazdugun.com 
bogazdugun.net 
bogazicibesyo.com 
bogazkoykres.com 
bogazkoykres.net 
bogazteknem.com 
borsapet.com 
bosal-cekidemiri.com 
bosphorusistanbul.org 
bossetekstil.com 
bostanlisatilik.net 
boxplastikas.com 
bozdemiravm.com 
bozuyukwebtasarim.com 
bukozmetik.com 
buldankayatekstil.com 
burdurdaevdenevenakliyat.com 
bursacepdatasi.com 
bursaisbir.com 
bursakoltukkanepe.com 
bursapanasonicservisi.com 
bursapanasonicservisi.net 
bursasonyservisi.com 
bursasonyservisi.net 
butaorganik.com 
buykd7globalgame.com 
buyukcekmecedugunsalonu.net 
buyuktatil.net 
buzdolabiyedekparca.net 
bycicekci.net 
cabralting.com 
cabukbaski.com 
cabukbaski.net 
caddecicek.net 
cagilduman.com 
canlialemdestek.com 
canliorganikgubre.com 
catsreklam.com 
cavdarnakliyat.com 
cekmeceinsaat.com 
celikshop.com 
cepazar.com 
cesmeoltabalikciligi.com 
ceyizterligi.com 
chandizsalon.net 
chapeapadana.com 
cicekdugunsarayi.com 
cicekduragi.net 
ciceksepetiavm.com 
cigerbagi.com 
cigercisavas.com 
cigkoftetatlises.org 
cihanabdullahoglu.com 
cihanabdullahoglu.net 
cilgindersane4.com 
cimritedarik.com 
cincetercumanlar.com 
cinselarkadas.com 
cinsellikegitimi.com 
cintedavisi.com 
citrabanjarabadi.com 
cizme.org 
clickmangalam.com 
cocugumaozel.com 
compuofertascorban.com 
corapfoni.com 
corbaadam.org 
corlupsikoteknik.com 
corlusrc.com 
corumcicekbahcesi.com 
crestkanarya.com 
cukurova-insaat.com 
culturistanbul.com 
dadamatik.com 
daimaorganik.com 
daimaorganik.net 
dalamaneso.org 
damatfincani.com 
davethehomebizadivsor.com 
dcolorpirlanta.com 
dedektifguvenlik.com 
dekolteicgiyim.com 
deminotekstil.com 
dergisanat.com 
dersimizbilgisayar.com 
derzkie-futbolki.com 
develiseyraniturizm.com 
diclecan.com 
diclesurucukursu.com 
didocicekcilik.com 
dihaber.com 
dijitaldizayn.net 
dikilijeotermal.com 
dilekbakir.com 
dingochick.com 
diskotek.tv 
divasenistanbul.org 
diyarbakircaremlak.com 
djasabahairi.com 
dk-istanbul.com 
dleedoners.com 
dogalsaglikguzellik.com 
doktorlarestetikmerkezi.com 
doktorlarguzellikmerkezi.com 
dokumantalist.com 
dolapburada.com 
domatesshop.com 
donergoznakliyat.com 
donerjim.com 
donnavenditasandali.com 
dortkalemdershanesi.com 
dtw-lazadaelektronik.com 
dugun-organizasyonu.org 
dugundekorasyonu.com 
dugunfotografcisiyim.com 
dugunorganizasyonfiyatlari.com 
dugunportal.org 
dumankaan.com 
dunedingolfcarts.com 
dusuncehareketi.org 
duzcecamasiryikama.com 
duzceutucu.com 
duzovaromork.com 
e-kadindogum.com 
e-kadindogum.net 
e-kursunkalem.com 
e-sekerkibris.com 
ecemuhendislik.com 
eceyavas.com 
eco-magazin.net 
ecomagazin.net 
eczapenceresi.com 
edebiyatsever.com 
edirnehayal.com 
edirnesrc.com 
edirnestaremlak.com 
efecanmakina.com 
efektiftarim.com 
egininsaat.net 
eji-haber.org 
ekiciplastik.com 
ekinhaber.com 
ekipelektrik.com 
ekonomibloggar.net 
ekonomiktoptangida.com 
ekranchat.com 
ekslibrisdukkani.org 
elabebeksekeri.com 
elebasi.com 
elektriklibattaniye-tr.com 
elektriklienjeksiyon.com 
elektronikmark.com 
elitkredikarttaksit.com 
elittturizm.com 
elmadestek.net 
emagelektronik.com 
emarankara.com 
emarantalya.com 
emaristanbul.com 
emarizmir.com 
emarturkiye.com 
emarturkiyehastanesi.com 
emlakbulten.net 
emlakcin.net 
emlakgezer.com 
emlakgoster.com 
emlakkonutdaireprojeleri.com 
emlaklike.com 
emobireklam.com 
emtmersin.com 
enderteknoloji.com 
enegitim.com 
enesorganikgida.com 
enguzelchat.com 
enguzelsozlerin.com 
eniyikimyapar.com 
eniyitasarim.com 
enstrumancarsisi.com 
enviodemedicamentos.com 
enviodemedicinas.com 
enyakinemlak.com 
epstemizlik.com 
erdemcicek.net 
erdememlakfatih.com 
erdemerkus.com 
erdemsevimli.com 
ereglionder.com 
erlinelektronik.com 
ernezmobilya.com 
ernezmobilya.net 
erolalyesil.com 
escortbayaneskisehir.com 
escortbayanilanlari.com 
escortbayankizlar.com 
esercenti.org 
eskiizmit.com 
eskisehirdurutemizlik.com 
eskisehirescortbayan.com 
esnafemlak.net 
esnafvesanatkarrehberi.com 
essaymage.com 
esyanakliyecileri.com 
etantakya.org 
eticaretinmerkezi.com 
euroguzellikmerkezi.com 
evbankasi.com 
evdedanismanlik.org 
evdedestek.com 
evdekorasyonsiteleri.com 
evdetasarruf.com 
evesyasinakliyecileri.com 
evlilikteklifiniz.net 
evnakliyecileri.com 
evrakindir.com 
fabrika-mishek.com 
farmasimersin.com 
faturaciyiz.com 
fauzanelektronik.com 
favorihaberler.net 
femteknoloji.com 
fenerkahve.com 
fenomentravel.com 
fersanetmangal.com 
finalguvenlik.com 
firmaeklebul.com 
firmamarket.com 
firmasayfalari.com 
firsatbuldum.com 
firsatstandi.com 
fitdayszayiflama.com 
fiyatpark.org 
fizikselpenetrasyontesti.com 
fliyaborek.com 
forumkalkan.com 
forzakakaonline.com 
foxesayakkabi.com 
fransizcaizmir.com 
fransizcaizmir.net 
fransizmir.net 
futbolafondo.com 
futbolask.com 
futbolinfinito.com 
futbolinfinito.net 
galatasaray-store.org 
galvanizacion-mad.com 
gavuranne.com 
gavurdagli.com 
gaymersinc.com 
gayrimenkulmarmaris.com 
gaziantepguvenlik.com 
gazipasadaemlak.com 
gebzedis.net 
gecicisilikon.com 
gehgeh.net 
gemlikcicekcileri.com 
gerceksismemanken.com 
gercektenkomik.com 
gerekenler.net 
gergedanboynuzuseti.net 
gergitavanlariantalya.com 
ginsanpia.com 
giresunileri.com 
globaltagger.com 
gobekind.com 
gokdenizbilisim.com 
golgeweb.com 
gonul-dizayn.com 
gonullucevreciler.com 
googlefirma.com 
gorkemmuhendislik.net 
goruklehaber.com 
goruntuisleme.com 
gracemignon.com 
greyfurtshop.com 
grupedginsaat.com 
grupodemesur.com 
grupoortopedico.com 
gufoyayinlari.com 
gulcenotomotiv.com 
gulhumartursun.com 
gulperuk.com 
gundoganisi.net 
gunesyapidanismanlik.com 
gurbuzkayseri.com 
gurpinardugunsalonu.com 
gursoyyapimersin.com 
guvenlikservisi.net 
guzelligi.com 
guzelsaclar.org 
guzelsoz.org 
guzergah-e-khayal.com 
habatakemottomukouhe.net 
haberdunyasi.net 
haberekstra.com 
haberindibi.net 
haberink.com 
haberink.net 
haberkalem.org 
habermeclisi.org 
habernu.com 
habernu.tv 
haberpet.com 
haberrler.net 
hafizakartci.net 
hafizogluinsaat.net 
haktankoltuk.com 
halikarnassomine.com 
haliyikama-istanbul.com 
hamura-town.com 
harfiyatsahibinden.org 
hatemelgenedy.com 
havaalaniizmirrentacar.com 
havalimanirentacarantalya.com 
havasakuk.com 
havuzda.com 
haziranbursa.com 
hd-belgesel-izle.com 
hdturkfilmleri.com 
hedefinsaatgida.com 
hediyegraf.com 
hediyegraf.net 
hediyeliksusesya.com 
hediyesepetiavm.com 
herbebekbirmelek.com 
herdaimradyo.org 
herihtiyacimicin.com 
herkesicinmuzik.com 
hidra.tv 
hidrojenyakitsistemi.com 
hilaryapiinsaat.com 
hizliepinal.com 
hizlimp3indir1.com 
hizlimp3indir1.net 
hizliokuveanla.com 
hizliuzat.org 
huoyunzaixian.com 
hurakdeniz.com 
hurma-zeytin.com 
huzurlucelikkapi.com 
huzurverenayrintilar.com 
hyundaisigorta.com 
iarcelik.com 
icipicipkazan.com 
icmimarlikistanbul.com 
ida2013istanbul.com 
ida2013istanbul.net 
iddaaji.com 
ihsanyazarli.com 
ihtiyaclarinburada.com 
ikincieldedegerkaybi.com 
ikincieldedegerkaybi.net 
ikincielesyadukkani.net 
ilkimkombiservisi.com 
imprimearabais.com 
imrozturizm.com 
inegolilaclama.com 
inegolsanatatolyesi.com 
inegolsinav.com 
infolaserdemo.com 
ingenicoyazarkasaposfiyatlari.com 
ingenicoyazarkasaposfiyatlari.net 
inkhaber.com 
intaniye.net 
ipgaraba.com 
iphone6-fiyati.com 
irinaayakkabi.com 
is-sagligi.org 
isarkadaslari.com 
isbirbursa.net 
isdanismanlik.com 
isguvenligimagazasi.com 
isiktanaydin.com 
isinibilenadamlar.com 
isitesisat.com 
iskenderunmedya.com 
ispartadaevdenevenakliyat.com 
ispartamazete.com 
istanbul-reisen24.com 
istanbuldusunceplatformu.com 
istanbulfayanskalebodurustasi.com 
istanbulgiyinmeodasi.com 
istanbulilrehberi.com 
istanbultences.com 
itsystemizers.com 
ivedikmedya.net 
iyapikredi.com 
iygunmobilya.com 
izbayticaret.com 
izkaucuk.com 
izmircocukendokrin.org 
izmirdecicek.net 
izmirfransizca.com 
izmirfransizca.net 
izmirfransizcakursu.com 
izmirfransizcakursu.net 
izmirmatematikozeldersi.com 
izmiroltabalikciligi.com 
izmirparkinsaat.com 
izmitboschservisi.net 
jinekolojidoktoru.com 
jinqiaoboyun.com 
jualkameraminidv.com 
kaancelik.net 
kabayanlive.com 
kabirbakim.com 
kadikoyklima.com 
kadinreyonu.net 
kafedekitap.com 
kahtaaksuemlak.com 
kahvearti.com 
kalemhaber.org 
kalemisidekor.com 
kampanyalihersey.com 
kampanyalimagazalar.com 
kamuflaj.net 
kanatdogramaci.com 
kanatdogramaci.net 
kankokumania.com 
kansersizyasamtv.org 
kapidaekmek.com 
karabukyurdu.com 
karaburunbutikotel.com 
karaburunotel.net 
karadenizailesi.com 
karadenizemlak52.com 
karadenizko.net 
karadenizoto.net 
karagozdekorasyon.net 
karaisalimedya.com 
karamanlilar.org 
karbon.tv 
karincashop.com 
kartalklima.com 
kartina9taksit.com 
kartoncu.com 
kartonkasaci.com 
kasapogluturizm.com 
kasapomer.com 
katarabalari.org 
kataraktameliyati.com 
katlanircambalkonizmit.com 
katlanircamizmit.com 
kavaklimarket.com 
kavakmedya.com 
kayantabela.com 
kaynaksomun.com 
kayrangrup.com 
kazanevi.com 
kedikopektakipshop.com 
keewayturkiye.com 
kefirdacqua.com 
kendinebaktiranreklamlar.com 
keskinotodizaynistanbul.com 
keskinprestijotel.com 
kimaykimya.com 
kingarackiralama.com 
kiralikfabrika.com 
kiralikfabrikalaristanbul.com 
kiralikluxarac.org 
kirkpinarayakkabi.com 
kitaphizi.com 
kitaphizir.com 
kitapsecek.com 
kitapseciyorum.com 
klasikburomobilyalari.com 
klasikburomobilyalari.net 
klasikburomobilyasi.com 
klasikburomobilyasi.net 
klasikofismobilyalari.com 
klasikofismobilyalari.net 
klasikofismobilyasi.com 
klasikofismobilyasi.net 
kocaelielsanatlari.com 
kocaklarinsaatemlak.com 
kodevreni.org 
kodturkiye.com 
kofteevibarisgunal.com 
koftem58.com 
kombiiservisi.com 
kombitesisati.net 
koncainsaatmalzemeleri.com 
konforservis.com 
konserans.com 
konserans.org 
konserttilippu.net 
konservieren-restaurieren.com 
konyayataysondaj.com 
korfezkayaduvar.com 
kosebasisofrafenerbahce.com 
kraloyuno.com 
kuafortr.org 
kuantumdusunceyontemi.com 
kucukaylar.com 
kuklaorganizasyon.com 
kurtulusturizm.com 
kurumsalblog.org 
kurumsaldata.org 
kurumsalplastik.com 
kurumsalsogutma.com 
kusadasibalikaviturlari.com 
kusadasiotelleri-tr.com 
kutahyakentmuzesi.com 
lahanashop.com 
lamonemuzik.com 
lanetlianahtar.com 
laptopteknikservis.org 
lastiginikilisi.com 
latartimegroup.com 
layflexlikitepdmkaucuk.com 
ledtabelamarketi.com 
lemankulturankara.com 
lemankulturankara.net 
lemankulturmersin.com 
lenaradyo.com 
levhan.com 
likitepdmkaucuk.com 
liondugunsalonu.com 
lisanskitabi.com 
lisanskitaplari.com 
lojistikservisi.net 
madenfloor.com 
mahanarabali.com 
mailmedya.com 
makarnaailesi.net 
makarnaailesi.tv 
maksialuminyum.com 
maksisineklik.com 
makyajistan.com 
makyajstandi.com 
malatyalaptop.com 
malatyasporkritik.com 
maltepenikahsalonu.com 
mamakels.com 
manavanasthali.com 
mangalbela.com 
mangalvidyalaya.com 
manisa-artinet.com 
mantaraygolf.com 
marmaratoptangida.net 
marmarisotelleri-tr.com 
masalsactasarim.com 
maskekipmankiralama.com 
maskodolap.com 
maskomutfak.com 
mavisehirsatilik.net 
maxibahis.com 
mayapsikoloji.com 
maydanozshop.com 
mebmemur.net 
meditasyonistanbul.com 
medyacankaya.com 
medyainci.com 
medyumiskenderadasay.com 
megabesint.com 
megafirsat.com 
mehmettemel.org 
mekatroniksepeti.com 
mektupsepetim.com 
melekfm.com 
memleketsivas.com 
memurbiledegilsin.com 
memurkufurleri.com 
merkezdecicekci.com 
merkezservisin.com 
merkeztelekom.org 
mersinemlakara.com 
mersinkardesticaret.com 
mersinkultursanat.org 
mersinlemankultur.com 
mersinsatiyorum.com 
mersintravel.com 
mertledtabela.com 
mesajhizmetleri.com 
mesutzeytinoglu.org 
meta-magazin.net 
metdogalgaz.com 
meteseviminsaat.com 
metin2bilisim.org 
metokompleks.com 
metokompleks.net 
metyemek.com 
meyveninsuyu.com 
michelvanoverbeeke.com 
mielteknikservis.com 
milantekstil.com 
milyarderyasam.com 
mimarlarmuhendisler.com 
miracyapidekorasyon.com 
miracyapidekorasyon.net 
mksistemleri.com 
mngevdenevenakliyat.org 
mobdunyasi.com 
mobilotomobil.com 
mobiloyunoyna.com 
mobilyapanayiri.com 
modabayankuaforuhopa.com 
modelgrafiktasarim.com 
modelkebayaterbaru.com 
modernburomobilyalari.net 
modernburomobilyasi.com 
modernburomobilyasi.net 
modernofismobilyasi.com 
modernofismobilyasi.net 
mokumanagame.com 
morturizm.com 
motoparcalari.com 
mtoyun.com 
mucevherdukkani.net 
mucizeegitim.com 
muglab.com 
muglads.com 
muglaekotv.com 
muglakitapligi.com 
mukemmelistmerkezi.org 
multimuzik.com 
muratkanatdogramaci.com 
muratkanatdogramaci.net 
muratli.net 
muratozdemir.org 
muselektrik.com 
mustafakucukkapdan.com 
mustafaotomotiv.com 
mustafayilmazsigorta.com 
mutfaktezgahcisi.com 
mutiarabalioleholeh.com 
nanemolla.com 
nanoburada.org 
nanosepeti.com 
nargrupinsaat.com 
nasogluinsaat.com 
naymanenerji.com 
naymanenerji.net 
nazarizolasyon.com 
nedenbursa.com 
nedensaglik.com 
netventeknoloji.org 
newcarsindia.com 
newyearsinistanbul.com 
nmatbaa.com 
noithatsacmau.com 
nommobilya.com 
normokamera.com 
normokamera.net 
novaorganik.com 
nurbilisim.com 
odaktercume.com 
ofisihtiyac.com 
ogrenciisleri.net 
ogrencilersoruyor.com 
oguzhanbakirci.com 
oldcitytransferistanbul.com 
omkmuhendislik.com 
onayplastikambalaj.com 
ongenerji.com 
onkainsaat.org 
onlinedergilik.com 
onlineduzce.com 
onlinekitapsec.com 
onlinesinavkitabi.com 
onsayfahaber.com 
onsayfahaberleri.com 
opelsigorta.com 
organikcanligubre.com 
organikcimadam.com 
organikdekorasyon.com 
organiktakilar.com 
organiktava.com 
organiktavatencere.com 
organiktrafik.com 
organiktrafik.net 
organizasyontoplanti.com 
orjinalbayancanta.com 
orjinalbayancanta.net 
orjinalbayancantalari.com 
orjinalbayancantalari.net 
orkinservis.com 
ortopediajuanpablo2.com 
otocekidemiri.com 
otomatikkapifirmasi.com 
otomotohaber.com 
oyp-ingilizce.com 
oyunarisi.com 
oyuncuolmakistiyorum.com 
oyundiyeti.com 
oyundoku.org 
oyunformum.com 
oyunkac.com 
oyunlarfriv.com 
oyunza.com 
oyunzamani.com 
ozdenticaretavm.com 
ozelbayanescort.com 
ozeldersegitimi.net 
ozelgunmuzikleri.com 
ozelolcuraydolap.com 
ozenkoltuk.com 
ozgunetemizlik.com 
ozgunradyo.net 
ozkaredenizgida.com 
ozlemduygudemir.com 
ozsoydasevdenevenakliyat.com 
ozturklerotomotivkorfez.com 
pabuccuogluyumurta.com 
padisah-macunum.com 
padisahmacunun.com 
pagoanonimo.com 
panasonicservisibursa.com 
panasonicservisibursa.net 
panjurankarasiteler.com 
paslanmazdepo.org 
paspaslogolu.com 
pazaryeri24.net 
pelinfidan.com 
petdergisi.com 
petgazetesi.com 
pikurumsal.com 
pinkorganik.com 
pishkhan-ramazani.com 
plastigil.com 
plastikacirugias.com 
polixterlik.com 
poncahillsfarm.net 
poobahism.com 
portakalimon.com 
postaguvercinimms.com 
postaguvercinitoplumms.com 
poyrazgucsistemleri.com 
printonlineankara.com 
profesyoneldanismanlik.com 
profesyoneldanismanlik.net 
profesyonelegitimler.net 
projemerkezi34.com 
psikolojiantalya.com 
psikolojimnasil.com 
quadrocopter-mit-kamera.com 
radyobaris.com 
raemlak.com 
raki.tv 
rasikaltin.com 
redcliffetoyota.com 
redverdemex.com 
reklamdayiz.com 
reklamdayiz.net 
remaxadana.com 
renkdegistirenangel.com 
renkdegistirenangelfar.com 
renkevdekorasyon.com 
renklibilyecocukyayinlari.com 
resimliguzelsozler.net 
retroturkiye.com 
rithabitkisel.com 
rockonus.com 
royalhoneyfirsat.com 
rpfutbol.com 
rumahcantikayesha.com 
ruscad.com 
saadettinaydin.com 
saatasarim.com 
saatasarim.net 
sabilgisayar.com 
sabunews.com 
sacbakim-haberi.com 
sadettinaydin.com 
safran88.com 
saglikliyasamhareketi.com 
sahibindenhinttoptangiyim.com 
sahibindenhinttoptangiyim.net 
sahinbilgisayar.net 
sahinsaat.com 
sahotokuafor.com 
sakaryatohm.org 
salatashop.com 
salehdanismanlik.com 
salyangozshop.com 
sametparkemobilya.com 
sanaladiyaman.com 
sanalpazaravm.com 
sanateniyihediyedir.com 
sanateniyihediyedir.net 
sanatreklamtabela.com 
sanattasarim.net 
sandiklievdenevenakliyat.com 
sanliurfagobeklitepe.com 
sanliyeniciftlikgayrimenkul.com 
saray-taranay.com 
satinalmadanismani.com 
saveursolidaire.com 
scanlifebiz.com 
seccadeburada.net 
sedefleyasam.net 
sedefleyasam.org 
sefakoyaskerimalzeme.com 
sekainihabatakegrapemint.net 
sekerkibris.com
sekliceticaret.com 
seksoyuncagi.com 
selalereklam.com 
selengemakina.com 
selimsimsek.com 
sembolalcipan.com 
semrakeskin.com 
semsetliekmek.com 
senturklernakliyat.com 
seramiksansporkulubu.org 
serdarogluotomotiv.net 
sevdemobilya.com 
sevgilimehediyemolsun.com 
sevilenlertekstil.org 
sicakgiyim.net 
sicakhava.com 
siemensizmitservis.com 
sifiremlak.com 
sigortahizmet.com 
sigortampark.com 
sigortampark.net 
sihirliaydinlatma.com 
sihirlibilisim.com 
sihirlitabela.com 
simsek-bayi.com 
sinekoc.com 
sinemadizifilm.com 
sinemahalle.net 
sinemaizletam.com 
sinemakine.com 
sinemavideolari.com 
sirguvenlik.com 
sirinevlergunlukkiralikdaireler.com 
sirkellegal.com 
sirnaktemizlik.com 
sisleme.net 
sismehavuzkapatma.com 
sivasakthigravuretheni.net 
sivastanbul.com 
sizincicekci.com 
skinorganik.net 
slimfitturkiye.com 
softmakerturkiye.com 
soganshop.com 
sohbetgiris.com 
sominehaberleri.com 
sonaxbalikesir.com 
sonfiyatburda.com 
sonmeztemizlik.com 
sonyservisibursa.com 
sonyservisibursa.net 
sosyalkazan.com 
spottabela.com 
staristanbul.org 
starsinistanbul.org 
starsistanbul.org 
straforduvar.com 
stratejikpolitikadernegi.org 
sudanismanlik.net 
suniteneffus.com 
surfadanac.com 
suryetkiliservis.com 
susamshop.com 
suzimutfakta.com 
t2medya.com 
tabelakutuharf.net 
tachrasazanco.com 
tammomuzik.com 
tarcinshop.com 
tarificadordeminutos.com 
tarimsalilanlar.com 
tarzyapidekorasyon.com 
tasarimgaraji.com 
tasarimofset.com 
tasit-tanima.net 
tatianamaslanynews.com 
tatil-yorum.com 
tatilkoyleri-tr.com 
tatlisesmagazin.com 
tatlisozluk.net 
tax-magazin.com 
taxmagazin.com 
tazeoyunlar.com 
teaslandia.com 
tebriklerikramiyekazandiniz.com 
tekirdagkbelgesi.com 
tekli.org 
teknikelcelikdovme.com 
teknoloji23.com 
teknolojigoral.com 
telepazarlama.net 
tellbaskinrobbiins.com 
temizellerhaber.com 
temizlerparlatirkorur.net 
temizlikaraclari.com 
tepesavunma.com 
tercaninsaat.net 
tesbihistanbul.com 
tescommuhendislik.com 
tfdestek.com 
therulesofmanbook.com 
thesandalfarm.com 
thule-cekidemiri.com 
tiendaorganizasyon.net 
tigirisideas.com 
tirparcalari.com 
tiryakidemir.com 
tiryakidemir.net 
toprakacar.com 
toptancantaimalat.com 
topuksshoes.com 
totemtabelaankara.com 
tozkoparanemlaktemizlik.com 
trabzonacicekgonder.com 
trabzonbil.com 
traktorab.com 
travelistanbulturkey.com 
trend-istanbul.net 
tresicgiyim.com 
tresicgiyim.net 
tropikalpeyzajantalya.com 
truvaoyunu.com 
tumdiyanetsen-istanbul.org 
tupbebekte.com 
turistturizm.com 
turizmas.com 
turk-tarim.com 
turkceogretiyorum.com 
turkhaberci.net 
turkiyedenizyolunakliye.com 
turkiyedenizyolunakliyecileri.com 
turkiyeesyanakliyecileri.com 
turkiyeevdenevenakliyeciler.com 
turkiyeevdenevenakliyecileri.com 
turkiyeevesyasinakliyecileri.com 
turkiyeevnakliyecileri.com 
turkiyehabermeclisi.net 
turkiyehabermeclisi.org 
turkiyehavayolunakliyeciler.com 
turkiyehavayolunakliyecileri.com 
turkiyekarapapaklari.org 
turkiyekarayolunakliye.com 
turkiyekarayolunakliyeciler.com 
turkiyekonteynirnakliyecileri.com 
turkiyemoda.net 
turkiyenakliyatambari.com 
turkiyenakliyeambari.com 
turkiyenakliyeciler.com 
turkiyenakliyecileri.com 
turkiyenakliyeonline.com 
turkiyenakliyerehberi.com 
turkiyenin1numarasi.com 
turkiyeninbirnumarasi.com 
turkiyeoyun.net 
turkiyeradyosu.com 
turkiyeyukborsasi.com 
turkiyeyukihale.com 
turkiyeyurticinakliyeciler.com 
turkiyeyurticinakliyecileri.com 
tweetmedya.com 
twinsandahalf.com 
twowaydiner.com 
ubeydullahaltinisik.com 
ucakbiletiatasehir.com 
ucakbiletikiziltoprak.com 
ucbirinci.com 
ucuzataksitli.com 
ucuztatil-tr.com 
uefaeurofutbol.com 
ufakhesaplar.com 
uflama.org 
ulkemhaber.net 
umitayazotomotiv.com 
umraniyecigkofte.com 
unaltarimsaldanismanlik.com 
usakhabernoktasi.com 
uskudarklima.com 
ustaellercigkofte.com 
ustaellercigkofte.net 
utaturizm.com 
uygunayakkabi.com 
uygunraydolap.com 
uzmancevaplar.com 
uzumbirebiregitim.com 
valdemirlivros.com 
vanyakakadinkoop.org 
vedikenstitu.com 
vellvettesarp.com 
verdabingol.net 
verdemarco.com 
verdemusic.com 
vestaturizm.com 
veysialtuninsaat.com 
videokaradeniz.com 
vikaye.org 
vincerzurum.com 
vipemlakdepo.com 
visneshop.com 
vitaminmanav.net 
vokabuler.com 
volkanhamamcioglu.com 
wargacelik-it.com 
webdebilgi.com 
webhatay.net 
weboyunlar.net 
webtekkers.com 
wfd2015istanbul.org 
worldcelik.com 
wupintuoyun.com 
xcanlimacsonuclari.com 
xhamsier.com 
yakrepost.com 
yapibilgisi.com 
yaradanakul.com 
yarengenclik.com 
yasamdestek.net 
yasamkocuegitimi.com 
yasamkocuistanbul.net 
yasamkocunedir.net 
yasaraydin.com 
yasinkalip.com 
yatakpartner.net 
yatirimtv.com 
yavuzinsaat.net 
yayasansarana.org 
yazarahmetozdemir.com 
yazarkafasi.com 
yelbogatasarim.com 
yelegim.org 
yelegim1.org 
yelegim2.org 
yelegim3.org 
yelegim4.org 
yelegim5.org 
yelegim6.org 
yelegim7.org 
yelegim8.org 
yelegim9.org 
yemekvesiz.com 
yemekyicem.com 
yeniarkadas.org 
yenideneskisehir.net 
yenihuzurturizm.com 
yeniturkiyeninvekili.net 
yerlifilm.org 
yerlikayanyazi.com 
yesimsahinn.com 
yilbasieglencesi.com 
yilbasioteli.org 
yilmazofsetmatbaa.com 
yogasankara.com 
yorukciftlik.com 
yoruktoptanyumurta.com 
yorukyumurta.com 
yteknoloji.com 
yucelkalip.com 
yumurtaci.org 
yunuscanozdemir.com 
yunustemizliksirketi.com 
yurtsevenlermobilya.com 
yuruyenreklamlar.com 
zaferhaber.net 
zarifcicekcilikankara.com 
zehraninmutfagi.com 
zeniarackiralama.com 
zeniarackiralama.net 
zeniotokiralama.com 
zeniotokiralama.net 
zeytinlabs.com 
zhenyavasilyeva.com 
zonguldaktasdemiremlak.com 
zuccaciyefirsat.com 

(Toplam 1272 domain)

Eski günlerde düşen domainlere ulaşmak için TIKLA.

Yazar Hakkında

Mustafa SEVİNÇ

Yorum Alanı