Domain Genel

(21-12-2015) boşa düşecek domainler

Bugün (21-12-2015) boşa düşecek, Türkçe alan adları aşağıdadır:

0224emlak.com 
100pour100toros.com 
2adamlabs.com 
38renkmedya.com 
3boyutsistemleri.com 
3d-projeksiyon.com 
3dluxoteller.com 
3kagit.com 
abakayseri.com 
abamerkezi.com 
abdalgalil-amin.com 
abiyekombini.com 
acemiegitimi.com 
adana-webtasarim.net 
adanabizdensorulur.com 
adanadaemlak.com 
adanakompresor.org 
adanaledgrafik.com 
adayerfistigi.com 
adendokuma.com 
adesnakliyat.com 
adresimdengetir.com 
adresimdengetir.net 
adresimegonder.com 
afyonfirmarehberi.com 
agasthiyarbiruhunaadi.com 
agvafirsatlari.com 
ahmetokatan.com 
aigenerji.com 
akgunsirketlergrubu.com 
akguvenliksistemleri.com 
akmanlarturizm.com 
aksakalli.com 
aktifsigortaltd.net 
alanyatrafiktakip.com 
alasozluk.com 
alexandruandrusca.com 
alinteriinsaat.com 
alisari-insaat.com 
alkandizel.com 
almancar.com 
altanlarnakliyat.com 
altinuc.com 
amesservis.info 
amesservis.org 
anayemekleri.biz 
anasaazi.com 
androidmuzik.com 
ankarabizdensorulur.com 
ankaracloud.com 
ankaramobilyadekorasyon.com 
ankaramobilyamontaj.com 
ankarayolyardimi.com 
annevekadin.net 
antakyagidapazari.com 
antalyaanaokullari.com 
antalyabilgiislem.com 
antalyamag.com 
antalyaotelleritatili.com 
antalyasuluk.com 
antalyatabela.net 
apakimya.com 
aquafarmutah.info 
aquafarmutah.org 
arabax.org 
arabeskci.org 
aracisizalisveris.com 
araklikartvizitalbumu.com 
arborsatlavista.com 
arimakinaltd.com 
arkadaslikodalari.com 
artipaslanmaz.com 
asrehber.com 
atabisiklet.com 
atakentemlak.net 
atikfirmalari.com 
atilganatasehirsurucukursu.com 
autoservisvintr.com 
autoservisvintr.net 
avcilaryasam.com 
avis-fidanimo.com 
avismobilya.com 
avukatgencligi.com 
avukatgencligi.net 
ayakkabium.com 
ayazbilisim.org 
aycanli.net 
aytortopedia.com 
babalarvapuru.com 
bademlerdekorasyon.com 
bagcilardevlethastanesi.net 
bagdatcaddeli.com 
baharestan-dc.com 
baharnakis.net 
banehistanbul.com 
baoyun17.com 
barabarac21.com 
basketbolkenti.com 
bayannaoerke.com 
belasandal.com 
belielektronik.com 
benimfikirlerimiz.com 
bereketotosamsun.com 
bergensmotorbaat.org 
berilnakliyat07.com 
beriltemizlik07.com 
beyazesyakusadasi.com 
beylikduzuevdenevenakliyatt.org 
bidunyakitap.biz 
bilginninsaat.com 
birecikgulbahcecocukevi.com 
bireyselpazarlama.com 
biricikbebegim.com 
birikimorganize.com 
birincitoner.com 
birkayalarinsaat.com 
blog-erkek.com 
bodrumbha.com 
bodrumdaarabakiralama.net 
bodrumdaarackiralama.net 
borsa-auto.com 
boschservismerkezi.com 
bostancidaelektrikci.com 
btparca.com 
bucakisguvenligi.com 
buildahugebuyerlist.com 
bulancakmedya.com 
bumipperkasapratama.com 
bunyamin.org 
burcyorumlarirehberi.com 
bursabeyin.com 
bursabeyinservisi.com 
bursabeyintamir.com 
bursabizdensorulur.com 
bursadaizolasyoncu.com 
bursaemaye.com 
bursalifeclub.com 
burung-biru.org 
buybrikablok.com 
cahayainsansuci.com 
cakancelik.com 
cakirkemer.com 
camzeminkaplama.com 
camzeminkaplama.net 
canlimuzikizmir.com 
caputbebek.com 
carryoncat.com 
carsionace.com 
carsioninc.com 
casaservise.com 
celikdemgida.com 
cennetkoydatca.com 
ceper.net 
cesmidantel.com 
cevizli.org 
cevrebakanligi.com 
cfdanismanlik.com 
cicilibicili.net 
ciftlikonuspor.org 
cigtatcigkofte.com 
cihanlarotomotiv.com 
cilginprojeistanbul.com 
cilginprojeistanbul.net 
ciltbeyazlaticikrem.net 
cimrifiyatlar.com 
cocuklaramasallar.com 
corluhayatsu.com 
corlusu.com 
corlusubayii.com 
coskunkarabilgin.com 
cosmesitermale.com 
cukurovaturizmhaber.com 
cumuhriyetciisadamlari.com 
cvjecaradomuz.com 
cylinsaat.com 
dalamantaxitransfers.org 
dalgicweb.com 
darabass.com 
darabass.net 
davetabut.com 
deendunya.com 
deendunya.org 
deendunyatv.com 
deendunyatv.org 
deercreekranchnews.com 
dekoratifkablo.com 
demirstyle.com 
denizkebap-lahr.com 
depoyazilimi.com 
devinimhaber.com 
devrenzenberger.com 
dewaltmagaza.com 
dibanyo.net 
digihomeguvenlik.com 
dijitalkamp.com 
dilhizmetleri.org 
direkenerji.com 
dishekimierolsaygi.com 
dnabankasi.com 
dnaveribankasi.com 
dogacotokiralama.com 
dogumermergranit.com 
doktorproktor.com 
doktorsaab.com 
dokunmatikakillitahta.com 
donmezreklam.com 
dosyakutuphanesi.com 
dugunkirklareli.com 
dugunpilavcisi.com 
dugunroportajlari.com 
dukkanistiyorum.net 
duman-ticaret.com 
duncanli.com 
e-baskifabrikasi.com 
ebrugizemnamli.com 
efendidenizcilik.com 
egeliinsaat.com 
egitimciyim.com 
ek-aryapimalzemeleri.com 
eko-zeytin.com 
eko-zeytinyagi.com 
ekolnakliyat.com 
ekonomiyaki.com 
ekonomizem.com 
ekonuslugi.com 
ekotatilci.com 
elazikcigkofte.com 
elektrikliaraclar.info 
elektriklimotor.info 
elektrikshop.org 
elektrikshopco.com 
elektronikmedya.com 
elektronikmedya.net 
elemegihediyeler.com 
elyapimihediyeler.com 
elyapimihediyeler.net 
elyapimipazari.com 
emaotokiralama.com 
emelcelikk.com 
emgemlak.com 
emitasyonaksesuar.com 
emlakciportali.net 
emlakdoor.com 
emrecanerdogan.net 
emrekitap.com 
encoenerji.com 
endustriyelmutfakuretimi.com 
enerjizone.com 
enguzelhikayemiz.net 
enguzelmobilyalar.com 
eniyikebapci.com 
ennkozmetik.com 
ensagliklitatil.com 
ensonulkehaberleri.com 
enucuzyatakodasi.com 
eraydemircelik.com 
erbaysabun.com 
erbaysabun.net 
erdemfoto.com 
erdoganuniversitesi.com 
ersoydemircelik.com 
ertangumustekin.com 
ertekininsaat.net 
esarpmodelleri.org 
escolastika.com 
escort35izmir.com 
escort35izmir.net 
escortankarabayan.net 
escortbayan6.com 
esenbahce.com 
eskisehirbizdensorulur.com 
especuladorbursatil.com 
estaayakkabi.com 
esteticabydenize.com 
estetikcerrahiankara.com 
eticaretforum.net 
etnakombiservisi.com 
etvetavukreyonlari.com 
eutsigorta.com 
evdekiyemekler.com 
evdekolay.org 
evdekorasyonrehberi.com 
evdenevenakliyeizmir.info 
evtekstilidunyasi.com 
exzotikicgiyim.com 
eyazilimprojeleri.com 
eyazilimprojeleri.net 
eynarelektrik.com 
fakirni.com 
fakiroglumobilya.com 
fal-eskisehir-tarot-i-ching.com 
falcikiz.com 
fatihevdenevenakliyatt.org 
fatosbebedenizli.com 
fatura42.com 
fenomenamedia.com 
ferforjekiralama.com 
ferforjemerdiven.com 
ferforjesandalye.com 
fiddiam-adv.com 
filmrehber.com 
filtre-mail.com 
firmaleie.org 
firmanekle.com 
firsatsa.com 
fiska.biz 
fixokuma.com 
fixreklam.net 
fiyatkovala.com 
folyoaluminyum.com 
forkliftistanbul.net 
formulguvenlik.com 
forzahaber.com 
frekansteknoloji.com 
frostmuzik.com 
futboltimes.com 
fx15turkiye.com 
garantibelgelerim.com 
gazipasaguvenlik.com 
gazipasaguvenlik.net 
gazipasakiralikaraba.com 
gazipasakiralikaraba.net 
gazipasakiralikarac.com 
gazipasakiralikarac.net 
gdinsaat.com 
gebzeevdenevenakliyat.biz 
gecegorusgozlugu.org 
gencavukatlar.com 
gencavukatlar.net 
gencreklam.net 
getdatcash.com 
gezicanakkale.net 
giamcanlic.com 
giamcanlic.net 
gitdatcash.com 
gizliklavyeler.com 
globalgalatasaray.com 
globalgalatasaray.net 
gonuloyunu.com 
goruntulutelefonlar.com 
goyunlar.com 
granit-servis.com 
groheyetkiliservisi.com 
grupsandal.com 
gulerdanismanlik.com 
gumusbol.com 
gumussamdan.com 
gumussekerlik.com 
gumustepsi.com 
guncelhaberoku.net 
guneslievdenevenakliyat.org 
gunlukkiraliklist.com 
gurplastikkalip.com 
guvenserbetci.com 
h2insaat.com 
habatake.net 
haberleri.info 
habertan.biz 
hakmadencilik.com 
halaminelbiseleri.com 
halfetimedya.com 
halkgiyim.com 
hamamatu3245.com 
haritadergisi.info 
haserelerilaclama.com 
hastalikresimleri.com 
hazaldogan.com 
hediyeforum.com 
hediyelikayakkabi.com 
hediyelikgiyim.com 
hediyeliktakilar.com 
helalbelgesinasilalinir.com 
helalbelgesinedir.com 
helalpazari.net 
helalsertifikasineredenalinir.com 
hepsidogalsabun.com 
herkeseyekoltuk.com 
herseysatislabaslar.com 
heykelmalzemeleri.com 
hiperaktif.org 
hoparlorizmir.com 
hotgiyims.com 
ibadanartsfestival.com 
ibox-kakaostory.com 
iesistanbul.org 
ignisservis.com 
ikenara.com 
ikiateknoloji.com 
ikincielpvcmakinasi.com 
ikonkozmetik.com 
ilkuvezmedya.com 
inan.org 
incimuhendislik.com 
inegolmobilyasi.biz 
infeksiyondunyasims.org 
insan365.com 
insanhayati.com 
instalservis.com 
intibadoner.org 
iqreklam.com 
isgdanismanlikkocaeli.com 
iskenderegzoz.com 
iskenderunadliyetaksi.com 
iskenderunemlak.net 
ispanyolcadersiizmir.com 
ispanyolcakursizmir.com 
istanbul-telekom.com 
istanbul911.org 
istanbulbizdensorulur.com 
istanbulbizdensorulur.net 
istanbuldaozelyurtlar.com 
istanbuldepremdayanismasi.com 
istanbuleskortlari.net 
istanbulraw.com 
istisare.org 
istockombiariza.com 
istoctesisat.com 
izmirbizdensorulur.com 
izmirescort5.net 
izmirlofts.com 
izmitescort1.com 
jeatasarim.com 
jeatasarim.net 
jinsansun.net 
kadikoyarcelikservis.org 
kadikoyevdenevenakliyatt.org 
kahvekokulukadin.com 
kahvekrizi.com 
kahveyemenden.net 
kahveyemendengelir.com 
kahveyemendengelir.net 
kakaogirls.com 
kaldirim.org 
kampanyalioteller.org 
kantarakubelize.com 
karadenizbeton.com 
karadenizfestivali.org 
karatoprakmt2.com 
karmagaza.net 
kartal1903.org 
kartvizitciizmir.com 
kastamonufirmarehberi.net 
kavak-pnu.com 
kayamakine.net 
kayisicim.com 
kayserigelisimmerkezi.com 
kayserihaberajansi.com 
kayseriotizm.com 
kayseriotokiralama.org 
kayserisahinsucuk.net 
kayserisucuklari.net 
kayseriyasammerkezi.com 
kentceviri.com 
kentkutahya.com 
kepenkyetkiliservis.com 
kesicibakimi.com 
keyifbodrum.com 
khadamateparand.info 
khadamateparand.org 
kilicogludekorasyon.com 
kiralikforkliftler.net 
kiralikvincburada.com 
kirikkalehazirbeton.com 
kirmiziescortajansi.com 
kirmizisozluk.com 
kirmizisozluk.net 
kiwieticaret.com 
klastekstil.com 
klimakusadasi.com 
kocaelikurye.com 
kocyigitaluminyum.com 
kofteciyakup.com 
kofteciyakup.net 
kombimarknaden.com 
kombiservisi42.com 
kontraktorapartemen.com 
kontraktorfutsal.com 
kontraktorlapanganfutsal.net 
kontraktortambang.com 
konusveogren.com 
konyadaemlak.com 
kredikartborcsorgula.net 
kredikartiborcogrenme.org 
kredikartiborcsorgulamak.net 
krnenerji.com 
krosscreekranch.com 
kuafornaif.com 
kudrettinakca.com 
kurumsal-kart-bayi.com 
kurumsalkartbayi.com 
kurumsalkartbayi.net 
kuzeykargo.com 
kyanidanismani.com 
kyaniturkiyeonline.com 
kyanizindeyasam.com 
laboneworld.com 
lafiligranademaria.com 
lapazfutbolclub.com 
laptopfiyat.com 
lastiktamirmalzemeleri.org 
learnbasicagile.com 
ledreklampanosu.com 
leri.biz 
lintasbahari.com 
luxkatlanirsandalye.com 
luxoteller3d.com 
maaambalika.org 
mackmuzik.com 
magazamonline.com 
magazamonline.net 
mahmut.info 
makinatesisat.com 
makinator.com 
makitamagaza.com 
makitaturkiye.net 
maltayurtdisiegitim.net 
maltepeevdenevenakliyatt.org 
maltepeleylimcafe.com 
mandingosluts.com 
mangalmgroup.com 
mankenresimlerim.com 
mantaro3.com 
marcsdanadana.com 
marinkablo.com 
markabursa.net 
marmaralazer.com 
marmarisbal.org 
martimobilya.net 
maskekuafor.com 
matarakyat.net 
matraxhaber.com 
maxdonerkebab.com 
mbzinsaat.com 
mekanikus.org 
memuralimi.com 
merkezistasyon.com 
metabomagaza.com 
miakumas.com 
midekanseritedavisi.com 
mikrofonizmir.com 
mizrakmuhendislik.com 
mkdekorasyon.com 
mobilyadekorasyontr.com 
mokakao.org 
montajkablosu.com 
montorosport.com 
morajansreklam.com 
motoelektronika.com 
motorbang.com 
movapure.com 
mtenerji.com 
muhendislikdanismanlik.com 
mustafahakankara.com 
muteveffa.com 
mutezile.org 
mutfakaski.com 
mutfakdolapfiyatlari.com 
muzik11.com 
mybalikesir.com 
na-magazin.com 
nabergenclik.com 
narakunosoko.com 
naravna-kozmetika.net 
neferguvenlik.com 
nefizeyildirim.com 
nevatipmerkezi.info 
nevatipmerkezi.org 
nevzatdemirci.com 
nikitamuzik.com 
nizipsabun.com 
nizipsabun.net 
nmarin-ortopedia.com 
nnturkiye.com 
noahbilisim.com 
nosusamos.com 
nurpazarlama.org 
nyazilim.net 
objektifveriler.com 
oburoyun.com 
odemegonder.com 
odemegonder.net 
ofisgiyim.com 
oguzhankarademir.com 
ohnowereoutofenergon.com 
okkereklamcilik.com 
okulsesizmir.com 
okulziliizmir.com 
okulzilsistemi.com 
oludenizevdenevenakliyat.com 
onaylama.com 
organize-reklam.com 
organnaklimerkezi.com 
oskartekstil.net 
otelistanbullist.com 
otizmdestekmerkezi.com 
otizmkayseri.com 
otokiralamakayseri.org 
otolastikbul.com 
otomatikpanjurservis.com 
otomobilimibul.com 
oykucicekevi.com 
oyuncehennemim.com 
oyunculukegitim.com 
oyunkarakterleri.com 
oyunkizlari.com 
oyunkolik.info 
oyuntan.com 
oyunutakipet.info 
ozbtekstil.com 
ozdemirlerdokum.com 
ozeldersaneler.net 
ozerhukukvedusuncedernegi.org 
ozsoytesisat.com 
pabloelmastemido.com 
panter-kangal.com 
paypal-servis.com 
pestarakyatfiska.com 
peyzajtemizlik.com 
pirantika.com 
pirlantayuzukler.org 
pixelhaber.com 
posiyunuss-shocko.info 
potansiyeldergisi.com 
pradanatours.com 
proyungas.org 
ptdeendayalviklangkalyansamiti.com 
puntootomotiv.com 
puntootomotiv.net 
raduvarkagitlari.com 
radyoasiyan.com 
radyodinlerim.net 
radyoduru.com 
radyovural.com 
rajaorganik.com 
rajareklame.com 
ramanavarapu.com 
ramazanalyu.com 
rapidetiketmakinesi.com 
ray-banturkiye.com 
raydolapevi.com 
rehberiyim.com 
rehberiyim.net 
rekayatirim.com 
remzitatilkoyu.com 
renklidavul.com 
resimagaci.com 
reyhani.biz 
ritmreklam.com 
rizetabela.com 
roketwebtasarim.com 
ruyatemizlik.com 
s-reklam.com 
saatevreni.com 
sabahbatik.com 
sabunsevdasi.com 
sabunsokagi.com 
safahatcocuk.net 
safahatyayinlari.net 
sahinkarakuzulu.com 
salehomealanya.com 
salfitillp.com 
samanyolucelikinsaat.com 
samphizmetleri.net 
samsunkardeslermermer.com 
sanalmuzikmarketim.com 
sandalini.com 
sandalyecimiz.com 
sanzimankonya.com 
sarayael.com 
sarayebouali.com 
sarihanreklam.com 
sariyerevdenevenakliyatt.org 
satilikforkliftler.net 
satinalmadanonce.org 
scanlifefree.com 
scanlifelocal.com 
scrabokumates.com 
seksdoktoru.net 
senbirmeleksin.net 
seoinsanfrancisco.net 
servisses.org 
sesanonssistemi.com 
sesduzeniizmir.com 
seslendirmesistemi.com 
seslidavet.com 
setekipmanlar.com 
sevenmobilya.net 
shamile.net 
shana-shambayati.com 
shesabitmuch.info 
shiptoyunnan.com 
shivantika.com 
sicaknokta.com 
sifabitki.com 
sigortacinet.com 
sincanweb.com 
sinemaorganizasyon.com 
sinoptik.info 
sirinevlerevdenevenakliyat.org 
sirket-ihayriye.com 
sirket-ihayriye.net 
sislievdenevenakliyatt.org 
sivasantavidyamandir.com 
skagit5orless.com 
sloven.biz 
sogukodasistemleri.com 
sogutgolgesi.net 
sohbetaskicom.com 
sokakoyun.com 
soyerasansor.com 
sozmendili.com 
sreemangal.info 
studyosessistemi.com 
sumantarafdar.com 
sumeyecicek.info 
supertraktorlig.com 
surucukursufiyatlari.com 
susogutuculari.com 
syafribahar.com 
tabelaimalatcisi.com 
tahirsahin.com 
tajofmarinsanrafaelca.com 
taksim-magazin.com 
tamarabalea.com 
tamirvetadilat.com 
tamtaraftar.com 
tanri.org 
tarakaglobal.com 
taramahariel.com 
tarsuskizkonukevi.com 
tartismasokagi.com 
tas-baski.com 
tastavuk.com 
tatsiz.com 
tayfunhalimobilya.com 
teknededugun.info 
teknikdanismanlikkocaeli.com 
temizlikpeyzaj.com 
temskuafor.com 
termomekanik.net 
thehaberdashclub.com 
tikir.net 
todoparasutractoleon.com 
topalogluenerji.com 
torbasizsupurge.info 
toroslarpompa.com 
trabzonkartvizitalbumu.com 
trabzontabela.com 
trafikalem.com 
trafobakimfirmalar.com 
trafoservis.net 
traktora.info 
trakyaboyutedirne.com 
tramvayyazilim.com 
tupbebekmerkezleri.biz 
turizmguncelhaber.com 
turkcellmesaj.com 
turkceuniversitesi.com 
turkceuniversitesi.net 
turkiyebizdensorulur.com 
turkiyegelisimmerkezleri.com 
turkiyegenelsecim2011.com 
turkiyemfm.com 
turunckirtasiye.com 
tuzlatedavimerkezi.com 
tuztedavimerkezi.com 
ucankediturkiye.com 
ucretsizfilmizle.net 
ucuzkitapdunyasi.net 
udaturkiye.com 
ugurdijitalfoto.com 
ulusoycelikkapi.com 
unalmacun.com 
uncareklam.com 
unyapiinsaat.com 
ussbilisim.com 
utomhusreklamen.com 
uykudaalmancaogrenme.com 
vaillant-kombi-servis.net 
vaillantkombiteknikservisleri.com 
vakitistanbul.com 
valjanservis.com 
vanilyanet.com 
varaldovizinho.com 
veganayakkabi.com 
vegangiyim.com 
vekadinlar.net 
webmagazam.net 
webyayinla.com 
wikilife.info 
wowturkiye.com 
woyaobanka.com 
wyattisabellekutcher.com 
xhaber.org 
yapienerjisistemleri.com 
yapienerjisistemleri.net 
yatakevi.net 
yemekim.net 
yemektarifiogren.com 
yeniardahan.org 
yenibilisimhukuku.com 
yenicarsi.net 
yeniguzelsozler.com 
yenihayatbilisim.net 
yenimedyahukuku.com 
yerindepcdestek.com 
yesilsehir.net 
yildiriminsaatgayrimenkul.com 
yildirimkardeslerahsap.com 
yildizligecelik.com 
yozgatfirmarehberi.com 
yuceogrenciyurdu.com 
yunusemrekeles.com 
yurtdisindaturkcedishekimligi.com 
yurtdisindaturkcedishekimligi.net 
yurtdisindaturkceeczacilik.com 
yurtdisindaturkceeczacilik.net 
yurtdisindaturkcefiziktedavi.com 
yurtdisindaturkcefiziktedavi.net 
yurtdisindaturkcehukuk.com 
yurtdisindaturkcehukuk.net 
yurtdisindaturkceinsaat.com 
yurtdisindaturkceinsaat.net 
yurtdisindaturkcemimarlik.com 
yurtdisindaturkcemimarlik.net 
yurtdisindaturkcepsikoloji.com 
yurtdisindaturkcepsikoloji.net 
yurtdisindaturkceuniversite.net 
yurtdisiturkcedishekimligi.com 
yurtdisiturkcedishekimligi.net 
yurtdisiturkceeczacilik.com 
yurtdisiturkceeczacilik.net 
yurtdisiturkcehukuk.com 
yurtdisiturkcehukuk.net 
yurtdisiturkceinsaat.com 
yurtdisiturkceinsaat.net 
yurtdisiturkcemimarlik.net 
yurtdisiturkcepsikoloji.com 
yurtdisiturkcepsikoloji.net 
yurtdisiturkceuniversite.com 
yurtdisiturkceuniversite.net 
yurtdisiturkceuniversitesi.com 
yurtdisiturkceuniversitesi.net 
zaman.info 
zemzemsuyu.net 
zenginmarket.com 
zonguldaktabela.com 

(Toplam 847 domain)

Eski günlerde düşen domainlere ulaşmak için TIKLA.

Yazar Hakkında

Mustafa SEVİNÇ

Yorum Alanı